PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010904917.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 312aa    MW: 34732.2 Da    PI: 7.4541
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010904917.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.64.1e-52111391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtd+el+ +yL++kv+++ ++l+++i+++d+yk++Pw+Lp k++ +e+ew+f+s+rd+ky++g+r+nra++sgyWkatg+dk++l++
  XP_010904917.1  11 LPPGFRFHPTDQELIIHYLRRKVTSTLTPLTSIIADIDLYKFNPWELPDKAYFGEREWFFYSPRDRKYPNGTRPNRAAASGYWKATGTDKPILTT 105
                     79****************************999***************888999****************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++  g+kk Lvfy+gr pkg+ktdWvmheyrl
  XP_010904917.1 106 gGSQCLGVKKALVFYTGRPPKGVKTDWVMHEYRL 139
                     566679**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-618167IPR003441NAC domain
PROSITE profilePS5100560.34111167IPR003441NAC domain
PfamPF023659.1E-2712139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MDGIGLSGSQ LPPGFRFHPT DQELIIHYLR RKVTSTLTPL TSIIADIDLY KFNPWELPDK  60
AYFGEREWFF YSPRDRKYPN GTRPNRAAAS GYWKATGTDK PILTTGGSQC LGVKKALVFY  120
TGRPPKGVKT DWVMHEYRLL NSNPTFSQKH KGSMRLDDWV LCRVRQKGAM PLETEENDLS  180
LHSSQPIINN QFAEKQATTG EKSGLFEWSD YQLLSYLMGS QNEGKTACEN SNRPESTDSS  240
GLDVAPGGCG ESQLPMVSSV LESIKRKLSF GALDELMLLP PAKRLNCSSS EGDNSSPAGS  300
VSVDQVYPQF MI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-691016714168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010904917.10.0PREDICTED: NAC transcription factor NAM-B2-like
SwissprotQ8GY422e-79NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A077RZD51e-104A0A077RZD5_WHEAT; Uncharacterized protein
STRINGPOPTR_0004s04920.11e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137971929
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-80NAC domain containing protein 25